Iright
BRAND / VENDOR: Proteintech

Proteintech, 15444-1-AP, TSPO/PBR Polyclonal antibody

CATALOG NUMBER: 15444-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TSPO/PBR (15444-1-AP) by Proteintech is a Polyclonal antibody targeting TSPO/PBR in WB, IHC, ELISA applications with reactivity to human, mouse samples 15444-1-AP targets TSPO/PBR in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TSPO, also named Peripheral-type benzodiazepine receptor (PBR), encodes the translocator protein, belonging to tryptophan-rich sensory protein family. The protein is mainly localized in the outer mitochondrial membrane and expressed in steroid-synthesizing tissues (PMID:32881658, PMID:1326278). TSPO is involved in the translocation of cholesterol from the outer to inner mitochondrial membrane (PMID:21119734). In response to injury, TSPO has a upregulated expression in the peripheral nervous system (PMID:32423330, PMID:23251719). TSPO is also as a biomarker in a non-invasive procedure including detecting the inflammation in the heart and atherosclerotic plaques (PMID:24402571). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7475 Product name: Recombinant human TSPO protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-169 aa of BC001110 Sequence: MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE Predict reactive species Full Name: translocator protein (18kDa) Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC001110 Gene Symbol: TSPO Gene ID (NCBI): 706 RRID: AB_3085462 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30536 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924