Product Description
Size: 20ul / 150ul
The NDUFA6 (15445-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
15445-1-AP targets NDUFA6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse heart tissue, human heart tissue, rat heart tissue
Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
NDUFA6 (NADH:Ubiquinone Oxidoreductase Subunit A6), also called LYR motif-containing protein 6 (LYRM6), or Complex I-B14 (CI-B14), or NADH-ubiquinone oxidoreductase B14 subunit, is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). NDUFA6 participates in the regulation of adipogenic differentiation.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag7593 Product name: Recombinant human NDUFA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-128 aa of BC002772 Sequence: SGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP Predict reactive species
Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6, 14kDa
Calculated Molecular Weight: 15 kDa
Observed Molecular Weight: 15 kDa
GenBank Accession Number: BC002772
Gene Symbol: NDUFA6
Gene ID (NCBI): 4700
RRID: AB_2267065
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P56556
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924