Proteintech, 15445-1-AP, NDUFA6 Polyclonal antibody

Size: 20ul / 150ul The NDUFA6 (15445-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15445-1-AP targets NDUFA6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, human heart tissue, rat heart tissue Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NDUFA6 (NADH:Ubiquinone Oxidoreductase Subunit A6), also called LYR motif-containing protein 6 (LYRM6), or Complex I-B14 (CI-B14), or NADH-ubiquinone oxidoreductase B14 subunit, is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). NDUFA6 participates in the regulation of adipogenic differentiation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7593 Product name: Recombinant human NDUFA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-128 aa of BC002772 Sequence: SGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6, 14kDa Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC002772 Gene Symbol: NDUFA6 Gene ID (NCBI): 4700 RRID: AB_2267065 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56556 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.