Iright
BRAND / VENDOR: Proteintech

Proteintech, 15449-1-AP, NSUN5 Polyclonal antibody

CATALOG NUMBER: 15449-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NSUN5 (15449-1-AP) by Proteintech is a Polyclonal antibody targeting NSUN5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15449-1-AP targets NSUN5 in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, human kidney tissue, human placenta tissue Positive IHC detected in: mouse skeletal muscle tissue, human placenta tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NSUN5 is a conserved RNA methyltransferase belonging to the Nop2/SUN domain family, which is highly conserved from archaea to eukaryotes and has close contact with RNA methylation because of their S-adenosyl methionine binding-domain. NSUN5 was a promoter in the progression of CRC mainly through cell cycle regulation (PMID: 32774740). Loss of NSUN5 induces growth phenotypes in mice and different mammalian cells, which is likely connected to the requirement of NSUN5 for ribosomal RNA modification and normal global protein translation, especially in highly proliferative cells (PMID: 31722427). Western blot analysis detected NSUN5 at an apparent molecular mass of 47 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7711 Product name: Recombinant human NSUN5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-466 aa of BC008084 Sequence: RNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRAAAGACTPPCT Predict reactive species Full Name: NOL1/NOP2/Sun domain family, member 5 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC008084 Gene Symbol: NSUN5 Gene ID (NCBI): 55695 RRID: AB_2153808 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96P11 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924