Proteintech, 15454-1-AP, S100A2 Polyclonal antibody

Size: 20ul / 150ul The S100A2 (15454-1-AP) by Proteintech is a Polyclonal antibody targeting S100A2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 15454-1-AP targets S100A2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HaCaT cells, HeLa cells Positive IHC detected in: human bowen diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information S100A2 (S100 calcium-binding protein A2) is also named as S100L and CAN19. S100A2, a member of the S100 protein family, is more highly expressed in endometrial carcinoma tissues than in normal tissues and was correlated with worse survival (PMID: 35042454). S100A2 has a tumor suppressor function. S100A2 is highly upregulated in the epidermis under inflammatory conditions and in drug eruptions, in addition to inflammatory skin diseases such as atopic dermatitis and psoriasis (PMID: 35885660). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7719 Product name: Recombinant human S100A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC002829 Sequence: MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP Predict reactive species Full Name: S100 calcium binding protein A2 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC002829 Gene Symbol: S100A2 Gene ID (NCBI): 6273 RRID: AB_3669209 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29034 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.