Proteintech, 15469-1-AP, CYB5B Polyclonal antibody

Size: 20ul / 150ul The CYB5B (15469-1-AP) by Proteintech is a Polyclonal antibody targeting CYB5B in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15469-1-AP targets CYB5B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse liver tissue, human liver tissue, mouse lung tissue, human adrenal gland tissue, rat liver tissue, rat lung tissue Positive IP detected in: mouse lung tissue Positive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CYB5B(Cytochrome b5 type B) is also named as CYB5M, OMB5 and belongs to the cytochrome b5 family. It is a 21 kDa membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. This protein is expressed on the plasma membrane of lymphoma cells but not normal lymphocytes, reactive lymphocytes or bone marrow precursor cells(PMID:20100355). The full length protein has a propeptide with 11 amino acids. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7771 Product name: Recombinant human CYB5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC004373 Sequence: MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPS Predict reactive species Full Name: cytochrome b5 type B (outer mitochondrial membrane) Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 20-21 kDa GenBank Accession Number: BC004373 Gene Symbol: CYB5B Gene ID (NCBI): 80777 RRID: AB_2230349 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43169 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.