Proteintech, 15471-1-AP, LIMD2 Polyclonal antibody

Size: 20ul / 150ul The LIMD2 (15471-1-AP) by Proteintech is a Polyclonal antibody targeting LIMD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15471-1-AP targets LIMD2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U-937 cells, Raji cells Positive IHC detected in: human ovary cancer tissue, human brain tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7775 Product name: Recombinant human LIMD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC004400 Sequence: MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEVDPGTKTA Predict reactive species Full Name: LIM domain containing 2 Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 16-20 kDa GenBank Accession Number: BC004400 Gene Symbol: LIMD2 Gene ID (NCBI): 80774 RRID: AB_10859817 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BT23 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.