Iright
BRAND / VENDOR: Proteintech

Proteintech, 15476-1-AP, NAT6/FUS2 Polyclonal antibody

CATALOG NUMBER: 15476-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NAT6/FUS2 (15476-1-AP) by Proteintech is a Polyclonal antibody targeting NAT6/FUS2 in WB, IF/ICC, ELISA applications with reactivity to human samples 15476-1-AP targets NAT6/FUS2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The acetyltransferase NAT6 (also known as Fus2) is an enzyme that catalyzes the transfer of acetyl groups from acetyl-CoA to acrylamines and located mainly in the cytoplasm. NAT6 has two isoforms. The molecular weight of NAT6 was detected to be about 45kDa (PMID:32978259). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7780 Product name: Recombinant human NAT6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-308 aa of BC004483 Sequence: MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI Predict reactive species Full Name: N-acetyltransferase 6 (GCN5-related) Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC004483 Gene Symbol: FUS2 Gene ID (NCBI): 24142 RRID: AB_3085463 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q93015 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924