Proteintech, 15489-1-AP, CPSF6 Polyclonal antibody

Size: 20ul / 150ul The CPSF6 (15489-1-AP) by Proteintech is a Polyclonal antibody targeting CPSF6 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 15489-1-AP targets CPSF6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, PC-3 cells, MDA-MB-231 cells, SW480 cells Positive IP detected in: HeLa cells Positive IHC detected in: human liver tissue, human heart tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SW480 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The binding of Cleavage factor Im (CFIM), also known as CPSF6, to the pre-mRNA is one of the earliest steps in the assembly of the cleavage and polyadenylation machinery and facilitates the recruitment of other processing factors. CFIM is required for the first step in pre-mRNA 3′-end processing and can be reconstituted in vitro from its heterologously expressed 25- and 68-kDa subunits. It involved in RNA binding, protein-protein interactions, and subcellular localization [PMID:15169763]. In addition, it is a pre-mRNA processing protein that dynamically shuttles between the nucleus and the cytoplasm and contains a C-terminal nuclear-targeting arginine/serine-rich (RS-) domain of the type bound by TNPO3[PMID:15169763,19864460]. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7852 Product name: Recombinant human CPSF6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC000714 Sequence: MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPGNLIKHLVKGTRPLFLETRIPWHMGHSIEEIPIFGLKAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQ Predict reactive species Full Name: cleavage and polyadenylation specific factor 6, 68kDa Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 55-68 kDa GenBank Accession Number: BC000714 Gene Symbol: CPSF6 Gene ID (NCBI): 11052 RRID: AB_10694140 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16630 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.