Iright
BRAND / VENDOR: Proteintech

Proteintech, 15530-1-AP, DHRS7B Polyclonal antibody

CATALOG NUMBER: 15530-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DHRS7B (15530-1-AP) by Proteintech is a Polyclonal antibody targeting DHRS7B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15530-1-AP targets DHRS7B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, LNCaP cells, MCF-7 cells, MDA-MB-231 cells, PC-3 cells Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DHRS7B (Dehydrogenase/Reductase 7B) is a member of the short-chain dehydrogenase/reductase (SDR) superfamily, a group of enzymes involved in redox reactions, particularly the metabolism of steroids, lipids, and xenobiotics. DHRS7B is characterized by its NAD(P)H-dependent oxidoreductase activity and plays roles in cellular detoxification, lipid homeostasis, and possibly steroid hormone regulation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7690 Product name: Recombinant human DHRS7B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-325 aa of BC004126 Sequence: ISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSIQGKMSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAVGKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKERKSKNS Predict reactive species Full Name: dehydrogenase/reductase (SDR family) member 7B Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC004126 Gene Symbol: DHRS7B Gene ID (NCBI): 25979 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6IAN0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924