Iright
BRAND / VENDOR: Proteintech

Proteintech, 15537-1-AP, CSTF1 Polyclonal antibody

CATALOG NUMBER: 15537-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CSTF1 (15537-1-AP) by Proteintech is a Polyclonal antibody targeting CSTF1 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 15537-1-AP targets CSTF1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, A549 cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Cleavage stimulation factor (CstF) , a heterotrimeric protein with subunits of 77, 64, and 50 kD (CstF-77, -64, and -50), is a polyadenylation factor that helps to specify the site of processing. CstF recognizes the G+U-rich element, a sequence located downstream of the cleavage site. CstF-50 unit interacts with the COOH-terminal domain of the RNAP II largest subunit (CTD). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7874 Product name: Recombinant human CSTF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-177 aa of BC007425 Sequence: MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVT Predict reactive species Full Name: cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC007425 Gene Symbol: CSTF1 Gene ID (NCBI): 1477 RRID: AB_2261143 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05048 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924