Proteintech, 15549-1-AP, PRPS1 Polyclonal antibody

Size: 20ul / 150ul The PRPS1 (15549-1-AP) by Proteintech is a Polyclonal antibody targeting PRPS1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15549-1-AP targets PRPS1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, rat spleen tissue, HeLa cells, Jurkat cells, mouse kidney tissue, rat kidney tissue Positive IP detected in: HeLa cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PRPS1, also named as Ribose-phosphate pyrophosphokinase 1, is a 318 amino acid protein, which belongs to the ribose-phosphate pyrophosphokinase family. PRPS1 can form Homodimer and the active form is probably a hexamer composed of 3 homodimers. PRPS1 catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) which is essential for nucleotide synthesis. PRPS1 as a module has an association with the Hepatocellular carcinoma. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7907 Product name: Recombinant human PRPS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-318 aa of BC001605 Sequence: MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL Predict reactive species Full Name: phosphoribosyl pyrophosphate synthetase 1 Calculated Molecular Weight: 318 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC001605 Gene Symbol: PRPS1 Gene ID (NCBI): 5631 RRID: AB_10694269 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60891 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.