Proteintech, 15573-1-AP, NDUFC2 Polyclonal antibody

Size: 20ul / 150ul The NDUFC2 (15573-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFC2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15573-1-AP targets NDUFC2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, human kidney tissue, human liver tissue, Hela cells, HepG2 cells, mouse brain tissue, mouse heart tissue, rat brain tissue Positive IHC detected in: human kidney tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7919 Product name: Recombinant human NDUFC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC007323 Sequence: MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC007323 Gene Symbol: NDUFC2 Gene ID (NCBI): 4718 RRID: AB_10666733 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95298 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.