Proteintech, 15575-1-AP, GMCL1 Polyclonal antibody

Size: 20ul / 150ul The GMCL1 (15575-1-AP) by Proteintech is a Polyclonal antibody targeting GMCL1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15575-1-AP targets GMCL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue Positive IHC detected in: human thyroid tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GMCL1, also named as GCL, functions in spermatogenesis. It enhances the degradation of MDM2 and increases the amount of p53 probably by modulating the nucleocytoplasmic transport. In WB test, the antibody recognizes 55 kDa band in our detection. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7929 Product name: Recombinant human GMCL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-347 aa of BC007420 Sequence: MGSLSSRVLRQPRPALAQQAQGARAGGSARRPDTGDDAAGHGFCYCAGSHKRKRSSGSFCYCHPDSETDEDEEEGDEQQRLLNTPRRKKLKSTSKYIYQTLFLNGENSDIKICALGEEWSLHKIYLCQSGYFSSMFSGSWKESSMNIIELEIPDQNIDVEALQVAFGSLYRDDVLIKPSRVVAILAAACLLQLDGLIQQCGETMKETVNVKTVCGYYTSAGTYGLDSVKKKCLEWLLNNLMTHQNVELFKELSINVMKQLIGSSNLFVMQVEMDIYTALKKWMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEGMAFLETEQGKPFVSVFRHLRLQYIISDLASAR Predict reactive species Full Name: germ cell-less homolog 1 (Drosophila) Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC007420 Gene Symbol: GMCL1 Gene ID (NCBI): 64395 RRID: AB_2878153 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96IK5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.