Proteintech, 15576-1-AP, IDH3B Polyclonal antibody

Size: 20ul / 150ul The IDH3B (15576-1-AP) by Proteintech is a Polyclonal antibody targeting IDH3B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15576-1-AP targets IDH3B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HuH-7 cells, Jurkat cells, LNCaP cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Isocitrate dehydrogenase 3 (IDH3) is a key enzyme in the mitochondrial tricarboxylic acid (TCA) cycle, which catalyzes the decarboxylation of isocitrate into α-ketoglutarate and concurrently converts NAD+ into NADH. IDH3B(Isocitrate dehydrogenase 3 (NAD+) beta), also named as RP46, is the beta subunit of IDH3 and controls its substrate levels in the TCA cycle, and it is required for sperm mitochondrial metabolism and spermiogenesis (PMID: 18806796, PMID: 35985423). In addition, DH3B expression increased PFKFB3 protein levels and enhanced glucose uptake, and high expression of IDH3B correlated with poor survival in patients with ESCC, suggesting a potential application of IDH3B in prognosis (PMID: 31053633). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7965 Product name: Recombinant human IDH3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-385 aa of BC001960 Sequence: MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS Predict reactive species Full Name: isocitrate dehydrogenase 3 (NAD+) beta Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC001960 Gene Symbol: IDH3B Gene ID (NCBI): 3420 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43837 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.