Proteintech, 15579-1-AP, CBX2 Polyclonal antibody

Size: 20ul / 150ul The CBX2 (15579-1-AP) by Proteintech is a Polyclonal antibody targeting CBX2 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 15579-1-AP targets CBX2 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse heart tissue, HeLa cells, MCF-7 cells, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information The chromobox homologue protein 2 (CBX2) is a critical component of the PRC1 complex involved in antiviral innate immunity, neuronal, and gonadal differentiation, axial patterning during embryonic development, cell proliferation, and senescence (PMID: 32870972). CBX2 has 2 isoforms with the molecular mass of 23 and 56 kDa. Sometimes higher molecular weight around 65-70 kDa can also be observed, which may be a modified variant of CBX2. Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7979 Product name: Recombinant human CBX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-211 aa of BC004252 Sequence: MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSPPLPGASCFSLSCTPLCWVAGSNCCRQALFPPRGSLGDGKEQEACVQ Predict reactive species Full Name: chromobox homolog 2 (Pc class homolog, Drosophila) Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC004252 Gene Symbol: CBX2 Gene ID (NCBI): 84733 RRID: AB_2737362 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14781 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.