Proteintech, 15598-1-AP, REXO2 Polyclonal antibody

Size: 20ul / 150ul The REXO2 (15598-1-AP) by Proteintech is a Polyclonal antibody targeting REXO2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15598-1-AP targets REXO2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, L02 cells Positive IHC detected in: human placenta tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7976 Product name: Recombinant human REX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC003502 Sequence: MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGT Predict reactive species Full Name: REX2, RNA exonuclease 2 homolog (S. cerevisiae) Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC003502 Gene Symbol: REXO2 Gene ID (NCBI): 25996 RRID: AB_10640529 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3B8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.