Proteintech, 15610-1-AP, CUTA Polyclonal antibody

Size: 20ul / 150ul The CUTA (15610-1-AP) by Proteintech is a Polyclonal antibody targeting CUTA in WB, IF/ICC, ELISA applications with reactivity to human samples 15610-1-AP targets CUTA in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IMR-32 cells, THP-1 cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CUTA also known as ACHAP, functions in cellular copper sensitivity and in the processing and trafficking of membrane proteins. CUTA, the mammalian CutA divalent cation tolerance homolog (E. coli), has been proposed to mediate acetylcholinesterase activity and copper homeostasis. Human CUTA has several variants that differ in N-terminal length and are separated as heavy (H) and light (L) components. The H component of human CUTA was associated with the membrane fraction, whereas the L component of human CUTA was in the cytosol(PMID: 22351782). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8000 Product name: Recombinant human CUTA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-156 aa of BC005890 Sequence: MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP Predict reactive species Full Name: cutA divalent cation tolerance homolog (E. coli) Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC005890 Gene Symbol: CUTA Gene ID (NCBI): 51596 RRID: AB_3669214 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60888 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.