Iright
BRAND / VENDOR: Proteintech

Proteintech, 15628-1-AP, EIF4EBP2 Polyclonal antibody

CATALOG NUMBER: 15628-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EIF4EBP2 (15628-1-AP) by Proteintech is a Polyclonal antibody targeting EIF4EBP2 in WB, ELISA applications with reactivity to human, mouse, rat samples 15628-1-AP targets EIF4EBP2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information EIF4EBP2(Eukaryotic translation initiation factor 4E-binding protein 2), also named as 4EBP2, is a member of the eukaryotic translation initiation factor 4E binding protein family. EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal stem cell renewal via its ability to repress translation initiation. EIF4EBP2 is a repressor of translation initiation involved in synaptic plasticity, learning and memory formation (PubMed:30765518). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8101 Product name: Recombinant human EIF4EBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC005057 Sequence: MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI Predict reactive species Full Name: eukaryotic translation initiation factor 4E binding protein 2 Calculated Molecular Weight: 120 aa, 13 kDa Observed Molecular Weight: 15-20 kDa GenBank Accession Number: BC005057 Gene Symbol: EIF4EBP2 Gene ID (NCBI): 1979 RRID: AB_3669215 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13542 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924