Iright
BRAND / VENDOR: Proteintech

Proteintech, 15630-1-AP, NRD1 Polyclonal antibody

CATALOG NUMBER: 15630-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NRD1 (15630-1-AP) by Proteintech is a Polyclonal antibody targeting NRD1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 15630-1-AP targets NRD1 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells Positive IHC detected in: mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NRD1(Nardilysin) is also named as NRD-C(N-arginine dibasic convertase). It is a zinc metalloendopeptidase of the M16 pitrilysin family that cleaves peptides at dibasic residues. The enzyme has also been found in neural tissues of mouse embryos indicating a role in neural development. Although nardilysin is primarily found in the cytosol, it has been reported that nardilysin is located on the cell surface acting as a receptor for heparinbinding EGF-like growth factor(PMID:15809022). It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7923 Product name: Recombinant human NRD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 801-1150 aa of BC008775 Sequence: YFNILIKPETLAKDVRLLILEYARWSMIDKYQALMDGLSLESLLSFVKEFKSQLFVEGLVQGNVTSTESMDFLKYVVDKLNFKPLEQEMPVQFQVVELPSGHHLCKVKALNKGDANSEVTVYYQSGTRSLREYTLMELLVMHMEEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGTQATKYNSEVVDKKIEEFLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFSKSDLVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFTTTLNLLPYHKIVK Predict reactive species Full Name: nardilysin (N-arginine dibasic convertase) Calculated Molecular Weight: 132 kDa Observed Molecular Weight: 135-140 kDa GenBank Accession Number: BC008775 Gene Symbol: NRD1 Gene ID (NCBI): 4898 RRID: AB_2154525 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43847 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924