Proteintech, 15631-1-AP, HSDL2 Polyclonal antibody

Size: 20ul / 150ul The HSDL2 (15631-1-AP) by Proteintech is a Polyclonal antibody targeting HSDL2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15631-1-AP targets HSDL2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IHC detected in: human liver cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Human hydroxysteroid dehydrogenase-like 2 (HSDL2) is a characterized SDR gene that not only catalyses the oxidation and reduction of multiple substrates but also regulates different metabolic and signalling pathways. Accumulating evidences suggest that HSDL2 play an important role in cancer progression. HSDL2 has promoting effects on tumor progression in papillary thyroid cancer, bladder cancer, ovarian cancer, and glioma, but has suppressing effects in cholangiocarcinoma . ( PMID: 31372054, PMID: 32211805) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7987 Product name: Recombinant human HSDL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-345 aa of BC004331 Sequence: MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALPCIVDVRDEQQISAAVEKAIKKFGAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEAVSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLKSKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL Predict reactive species Full Name: hydroxysteroid dehydrogenase like 2 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC004331 Gene Symbol: HSDL2 Gene ID (NCBI): 84263 RRID: AB_2120238 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6YN16 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.