Proteintech, 15638-1-AP, OPA3 Polyclonal antibody

Size: 20ul / 150ul The OPA3 (15638-1-AP) by Proteintech is a Polyclonal antibody targeting OPA3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15638-1-AP targets OPA3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, human kidney tissue, mouse thymus tissue, Jurkat cells, HeLa cells, HEK-293T cells Positive IP detected in: HeLa cells Positive IHC detected in: human liver tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The OPA3 cDNA encodes a deduced 179-amino acid protein. Northern blot analysis demonstrated a primary transcript of approximately 5.0 kb that was ubiquitously expressed, most prominently in skeletal muscle and kidney. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8103 Product name: Recombinant human OPA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-179 aa of BC005059 Sequence: ANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK Predict reactive species Full Name: optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) Calculated Molecular Weight: 179 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC005059 Gene Symbol: OPA3 Gene ID (NCBI): 80207 RRID: AB_2158168 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6K4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.