Proteintech, 15639-1-AP, ADPGK Polyclonal antibody

Size: 20ul / 150ul The ADPGK (15639-1-AP) by Proteintech is a Polyclonal antibody targeting ADPGK in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15639-1-AP targets ADPGK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, MOLT-4 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ADP-dependent glucokinase (ADPGK) has frst been described 1994 in hyperthermophilic archaea as a novel glucose-phosphorylating enzyme dependent on ADP (adenosine diphosphate) instead of ATP (adenosine triphosphate). Highest ADPGK expression is found in immune cells of both myeloid and lymphoid lineages. Catalyzes the phosphorylation of D-glucose to D-glucose 6-phosphate using ADP as the phosphate donor. GDP and CDP can replace ADP, but with reduced efficiency (By similarity). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8105 Product name: Recombinant human ADPGK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-497 aa of BC006112 Sequence: EFPGAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY Predict reactive species Full Name: ADP-dependent glucokinase Calculated Molecular Weight: 497 aa, 54 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC006112 Gene Symbol: ADPGK Gene ID (NCBI): 83440 RRID: AB_2224911 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRR6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.