Proteintech, 15651-1-AP, GINS3 Polyclonal antibody

Size: 20ul / 150ul The GINS3 (15651-1-AP) by Proteintech is a Polyclonal antibody targeting GINS3 in WB, IP, ELISA applications with reactivity to human, mouse samples 15651-1-AP targets GINS3 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, NIH/3T3 cells Positive IP detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8247 Product name: Recombinant human GINS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-216 aa of BC005879 Sequence: MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED Predict reactive species Full Name: GINS complex subunit 3 (Psf3 homolog) Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC005879 Gene Symbol: GINS3 Gene ID (NCBI): 64785 RRID: AB_2247477 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRX5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.