Proteintech, 15669-1-AP, VPS25 Polyclonal antibody

Size: 20ul / 150ul The VPS25 (15669-1-AP) by Proteintech is a Polyclonal antibody targeting VPS25 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15669-1-AP targets VPS25 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, human brain tissue, mouse liver tissue, A549 cells, rat liver tissue, mouse brain tissue Positive IHC detected in: human breast cancer tissue, mouse brain tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information VPS25 is a component of the endosome-associated complex ESCRT-II (Endosomal Sorting Complexes Required for Transport protein II). ESCRT-II complex, composed of VPS25, VPS36, and SNF8, functions in sorting of ubiquitinated membrane proteins during endocytosis. ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. VPS25 is highly conserved. Human VPS25 gene maps to chromosome 17q21.31 and is expressed in a wide range of tissues (PMID: 16889659). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8134 Product name: Recombinant human VPS25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC006282 Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF Predict reactive species Full Name: vacuolar protein sorting 25 homolog (S. cerevisiae) Calculated Molecular Weight: 176 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC006282 Gene Symbol: VPS25 Gene ID (NCBI): 84313 RRID: AB_2215019 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.