Proteintech, 15685-1-AP, UBE2H Polyclonal antibody

Size: 20ul / 150ul The UBE2H (15685-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2H in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15685-1-AP targets UBE2H in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse brain tissue, mouse kidney tissue, HeLa cells, rat brain tissue, rat kidney tissue Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8187 Product name: Recombinant human UBE2H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC006277 Sequence: MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL Predict reactive species Full Name: ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) Calculated Molecular Weight: 183 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC006277 Gene Symbol: UBE2H Gene ID (NCBI): 7328 RRID: AB_10858632 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62256 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.