Proteintech, 15702-1-AP, PCBD1 Polyclonal antibody

Size: 20ul / 150ul The PCBD1 (15702-1-AP) by Proteintech is a Polyclonal antibody targeting PCBD1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 15702-1-AP targets PCBD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse pancreas tissue Positive IHC detected in: mouse liver tissue, human liver cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PCBD1, also known as DCOH and PCBD, belongs to the pterin-4-alpha-carbinolamine dehydratase family. PCBD1 is a bifunctional protein that acts as an enzyme in the regeneration of cofactor tetrahydrobiopterin (BH4), crucial for the function of aromatic amino acid hydroxylases, and as a dimerization cofactor of transcription factors HNF1A and HNF1B, important in liver and pancreas development and function. PCBD1 is expressed in the developing pancreas. The calculated molecular weight of PCBD1 is 12 kDa (PMID: 24204001, 24848070). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8331 Product name: Recombinant human PCBD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC006324 Sequence: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT Predict reactive species Full Name: pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha Calculated Molecular Weight: 104 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC006324 Gene Symbol: PCBD1 Gene ID (NCBI): 5092 RRID: AB_2267945 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61457 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.