Iright
BRAND / VENDOR: Proteintech

Proteintech, 15710-1-AP, AMPD2 Polyclonal antibody

CATALOG NUMBER: 15710-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AMPD2 (15710-1-AP) by Proteintech is a Polyclonal antibody targeting AMPD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15710-1-AP targets AMPD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue, HepG2 cells Positive IHC detected in: human cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information Adenosine monophosphate deaminase (AMPD) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle. Three AMPDs are present in mammals named AMPD1/2/3. AMPD2 is the main activity present in adult human liver and is widely expressed in non-muscle tissues and cells (PMID: 8526848). AMPD2 has some isoforms with the molecular mass of 88-101 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8335 Product name: Recombinant human AMPD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 448-798 aa of BC007711 Sequence: LEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELALITQAVQSEMLETIPEEAGITMSPGPQ Predict reactive species Full Name: adenosine monophosphate deaminase 2 (isoform L) Calculated Molecular Weight: 879aa,101 kDa; 798aa,92 kDa Observed Molecular Weight: 101 kDa GenBank Accession Number: BC007711 Gene Symbol: AMPD2 Gene ID (NCBI): 271 RRID: AB_2242657 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01433 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924