Iright
BRAND / VENDOR: Proteintech

Proteintech, 15716-1-AP, RIMBP2 Polyclonal antibody

CATALOG NUMBER: 15716-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RIMBP2 (15716-1-AP) by Proteintech is a Polyclonal antibody targeting RIMBP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15716-1-AP targets RIMBP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The presynaptic active zone mediates synaptic vesicle exocytosis at a synapse. RIM proteins are active zone scaffolding molecules that--among others--mediate vesicle priming and directly or indirectly interact with most other essential presynaptic proteins. RIMBP2 encodes RIMS-binding protein 2 belonging to RIMBP family. RIMBP2 is supposed to be localized at cell membrane especially synaptic plasma membrane. By interacting with RIMS1, RIMS2, CACNA1D and CACNA1B via the SH3 domains, RIMBP2 mediates synaptic transmission as bifunctional linker. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8390 Product name: Recombinant human RIMBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC007632 Sequence: MNGLATSLGKGQESAIGGSSAIGEYIRPLPQPGDRPEPLSAKPTFLSRSGSARCRSESDMENERNSNTSKQRYSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFVQDNESRLASTLGNEQDQNFINHSGIGLEGEHILDLHSPTHIDAGITDNSAGTLDVNIDDIGEDIVPYPRKITLIKQLAKSVIVGWEPPAVPPGWGTVSSYNVLVDKETRMNLTLGSRTKALIEKLNMAACTYRISVQCVTSRGSSDELQCTLLVGKDVVVAPSHLRVDNITQISAQLSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFF Predict reactive species Full Name: RIMS binding protein 2 Calculated Molecular Weight: 116 kDa Observed Molecular Weight: 120-150 kDa GenBank Accession Number: BC007632 Gene Symbol: RIMBP2 Gene ID (NCBI): 23504 RRID: AB_2878173 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15034 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924