Iright
BRAND / VENDOR: Proteintech

Proteintech, 15721-1-AP, SNX9 Polyclonal antibody

CATALOG NUMBER: 15721-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SNX9 (15721-1-AP) by Proteintech is a Polyclonal antibody targeting SNX9 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15721-1-AP targets SNX9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat heart tissue, human heart tissue, mouse skeletal muscle tissue, mouse heart tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX9 (Sorting nexin-9, also known as SH3PX1) was originally identified as a protein that interacted with the metalloproteinases ADAM9 and ADAM15. It contains a PX and an Sec homology 3 (SH3) domain. SNX9 functions in clathrin-mediated endocytosis and clathrin-independent, actin-dependent fluid-phase endocytosis (PMID: 17609109). On SDS-PAGE, SNX9 migrates at a molecular weight (70-78 kDa) higher than its calculated molecular mass of 67 kDa (PMID: 15299020; 12952949; 18411244; 15703209). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8440 Product name: Recombinant human SNX9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-362 aa of BC005022 Sequence: MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAHASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEW Predict reactive species Full Name: sorting nexin 9 Calculated Molecular Weight: 595 aa, 67 kDa Observed Molecular Weight: 78 kDa GenBank Accession Number: BC005022 Gene Symbol: SNX9 Gene ID (NCBI): 51429 RRID: AB_2286415 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5X1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924