Proteintech, 15724-1-AP, CRTAP Polyclonal antibody

Size: 20ul / 150ul The CRTAP (15724-1-AP) by Proteintech is a Polyclonal antibody targeting CRTAP in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15724-1-AP targets CRTAP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-1080 cells, HEK-293 cells, HeLa cells, human colon tissue, human stomach tissue, NIH/3T3 cells, ROS1728 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8459 Product name: Recombinant human CRTAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-401 aa of BC008745 Sequence: HALDKYSGEHWAESVGYLEISLRLHRLLRDSEAFCHRNCSAAPQPEPAAGLASYPELRLFGGLLRRAHCLKRCKQGLPAFRQSQPSRDVLADFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLETKSYESLFIRAVRAYNGENWRTSITDMELALPDFFKAFYECLAACEGSREIKDFKDFYLSIADHYVEVLECKIQCEENLTPVIGGYPVEKFVATMYHYLQFAYYKLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS Predict reactive species Full Name: cartilage associated protein Calculated Molecular Weight: 46.5 kDa Observed Molecular Weight: 43-47 kDa GenBank Accession Number: BC008745 Gene Symbol: CRTAP Gene ID (NCBI): 10491 RRID: AB_2261089 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75718 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.