Iright
BRAND / VENDOR: Proteintech

Proteintech, 15734-1-AP, MIA Polyclonal antibody

CATALOG NUMBER: 15734-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MIA (15734-1-AP) by Proteintech is a Polyclonal antibody targeting MIA in IHC, ELISA applications with reactivity to human, mouse, rat samples 15734-1-AP targets MIA in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human skin cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Melanoma-derived growth regulatory protein, also known as MIA, CD RAP, is a protein that in humans is encoded by the MIA gene. It is a marker for malignant melanoma (PMID: 9242442). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8499 Product name: Recombinant human MIA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-131 aa of BC005910 Sequence: GGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ Predict reactive species Full Name: melanoma inhibitory activity Calculated Molecular Weight: 131 aa, 15 kDa GenBank Accession Number: BC005910 Gene Symbol: MIA Gene ID (NCBI): 8190 RRID: AB_2878176 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16674 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924