Proteintech, 15750-1-AP, CRYBA2 Polyclonal antibody

Size: 20ul / 150ul The CRYBA2 (15750-1-AP) by Proteintech is a Polyclonal antibody targeting CRYBA2 in WB, ELISA applications with reactivity to human, mouse, rat samples 15750-1-AP targets CRYBA2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, rat eye tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information CRYBA2, also named as Beta A2 crystallin, is a member of crystallin superfamily. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also defined as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Crystallins are the dominant structural components of the vertebrate eye lens. The MW of this protein is 22 kDa, and this antibody specially recognises the 22 kDa protein. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8222 Product name: Recombinant human CRYBA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-197 aa of BC006285 Sequence: MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFILEKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH Predict reactive species Full Name: crystallin, beta A2 Calculated Molecular Weight: 197 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC006285 Gene Symbol: CRYBA2 Gene ID (NCBI): 1412 RRID: AB_2878180 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53672 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.