Proteintech, 15764-1-AP, MID1IP1 Polyclonal antibody

Size: 20ul / 150ul The MID1IP1 (15764-1-AP) by Proteintech is a Polyclonal antibody targeting MID1IP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 15764-1-AP targets MID1IP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information MID1IP1, also named as Mid1-interacting protein 1 or Gastrulation-specific G12-like protein, is a 183 amino acid protein, which belongs to the SPOT14 family. MID1IP1 plays a role in the regulation of lipogenesis in liver. MID1IP1 may localizes in the nucleus and cytoplasm. MID1IP1 may form Homodimer in the absence of THRSP. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8400 Product name: Recombinant human MID1IP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC008908 Sequence: MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH Predict reactive species Full Name: MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) Calculated Molecular Weight: 183 aa, 20 kDa Observed Molecular Weight: 23 kDa, 46 kDa GenBank Accession Number: BC008908 Gene Symbol: MID1IP1 Gene ID (NCBI): 58526 RRID: AB_2878181 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPA3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.