Proteintech, 15792-1-AP, S100A8 Polyclonal antibody

Size: 20ul / 150ul The S100A8 (15792-1-AP) by Proteintech is a Polyclonal antibody targeting S100A8 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 15792-1-AP targets S100A8 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, A549 cells, COLO 320 cells, THP-1 cells, MCF-7 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: mouse lung tissue, human stomach cancer tissue, rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse stomach tissue, mouse lung tissue, mouse spleen tissue Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. S100A8 may form homodimer or heterodimer with S100A9(16216873). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8500 Product name: Recombinant human S100A8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC005928 Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Predict reactive species Full Name: S100 calcium binding protein A8 Calculated Molecular Weight: 93 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC005928 Gene Symbol: S100A8 Gene ID (NCBI): 6279 RRID: AB_10666315 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05109 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.