Proteintech, 15806-1-AP, GRIPAP1 Polyclonal antibody

Size: 20ul / 150ul The GRIPAP1 (15806-1-AP) by Proteintech is a Polyclonal antibody targeting GRIPAP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15806-1-AP targets GRIPAP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GRIP-associated protein-1 (GRASP-1), also named as GRIPAP1, is a neuron-specific effector of the small GTPase Rab4 and key component of AMPA receptor recycling machinery in dendrites. GRASP-1 is essential for maintenance of spine morphology and important for LTP. GRASP-1 connects Rab4 and Rab11 recycling endosomal domains through the interaction with target (t)-SNARE syntaxin. The MW of this protein is 97 kDa, and Catalog#15806-1-AP specially recognises the 97 kDa protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8540 Product name: Recombinant human GRIPAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 292-587 aa of BC001522 Sequence: QEERDCHLKTISSLKQEVKDTVDGQRILEKKGSAALKDLKRQLHLERKRADKLQERLQDILTNSKSRSGLEELVLSEMNSPSRTQTGDSSSISSFSYREILREKESSAVPARSLSSSPQAQPPRPAELSDEEVAELFQRLAETQQEKWMLEEKVKHLEVSSASMAEDLCRKSAIIETYVMDSRIDVSVAAGHTDRSGLGSVLRDLVKPGDENLREMNKKLQNMLEEQLTKNMHLHKDMEVLSQEIVRLSKECVGPPDPDLEPGETS Predict reactive species Full Name: GRIP1 associated protein 1 Calculated Molecular Weight: 841 aa, 96 kDa Observed Molecular Weight: 97 kDa GenBank Accession Number: BC001522 Gene Symbol: GRIPAP1 Gene ID (NCBI): 56850 RRID: AB_2112787 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4V328 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.