Iright
BRAND / VENDOR: Proteintech

Proteintech, 15811-1-AP, Centrin 3 Polyclonal antibody

CATALOG NUMBER: 15811-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Centrin 3 (15811-1-AP) by Proteintech is a Polyclonal antibody targeting Centrin 3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 15811-1-AP targets Centrin 3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NCI-H1299 cells, C2C12 cells, Neuro-2a cells, mouse ovary tissue, mouse testis tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Centrin 3 protein is a highly conserved calcium-binding protein that belongs to the EF-hand calcium-binding protein superfamily and contains four calcium-binding domains. It is primarily located in structures associated with the microtubule-organizing center within cells. Centrin 3 plays a crucial role in centriole duplication, which is essential for the bipolarity of cell division. Additionally, Centrin 3 is involved in inhibiting the activity of the centrosomal Mps1 kinase and has an antagonistic relationship with the function of Centrin 2. Recent studies have shown that CETN3 interacts with USP49 to participate in RNA splicing processes in neural stem/progenitor cells, thereby indirectly affecting the cell cycle and neural development. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8547 Product name: Recombinant human CETN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC005383 Sequence: MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI Predict reactive species Full Name: centrin, EF-hand protein, 3 (CDC31 homolog, yeast) Calculated Molecular Weight: 167 aa, 20 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC005383 Gene Symbol: Centrin 3 Gene ID (NCBI): 1070 RRID: AB_2082361 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15182 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924