Proteintech, 15838-1-AP, GSTT1 Polyclonal antibody

Size: 20ul / 150ul The GSTT1 (15838-1-AP) by Proteintech is a Polyclonal antibody targeting GSTT1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15838-1-AP targets GSTT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, rat liver tissue, mouse brain tissue, mouse liver tissue, HepG2 cells Positive IHC detected in: human kidney tissue, human testis tissue, human skin tissue, human spleen tissue, human lung tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GSTT1 belongs to the GST superfamily and Theta family. It is a conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. GSTT1 acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. It displays glutathione peroxidase activity with cumene hydroperoxide. GSTM1 and GSTT1 has been suggested as a risk factor in various cancers. GSTT1 is important in the detoxification of unidentified xenobiotics in the large intestine. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8588 Product name: Recombinant human GSTT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-240 aa of BC007065 Sequence: MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR Predict reactive species Full Name: glutathione S-transferase theta 1 Calculated Molecular Weight: 240 aa, 27 kDa Observed Molecular Weight: 28 kDa, 30 kDa GenBank Accession Number: BC007065 Gene Symbol: GSTT1 Gene ID (NCBI): 2952 RRID: AB_2116344 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30711 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.