Proteintech, 15850-1-AP, REG Polyclonal antibody

Size: 20ul / 150ul The REG (15850-1-AP) by Proteintech is a Polyclonal antibody targeting REG in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15850-1-AP targets REG in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas tissue Positive IHC detected in: human stomach cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8640 Product name: Recombinant human REG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC005350 Sequence: MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN Predict reactive species Full Name: regenerating islet-derived 1 alpha Calculated Molecular Weight: 166 aa, 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC005350 Gene Symbol: REG Gene ID (NCBI): 5967 RRID: AB_2878192 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05451 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.