Proteintech, 15852-1-AP, PPP6C Polyclonal antibody

Size: 20ul / 150ul The PPP6C (15852-1-AP) by Proteintech is a Polyclonal antibody targeting PPP6C in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 15852-1-AP targets PPP6C in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, HEK-293 cells, human testis tissue, NIH/3T3 cells, rat testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8670 Product name: Recombinant human PPP6C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-305 aa of BC006990 Sequence: MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL Predict reactive species Full Name: protein phosphatase 6, catalytic subunit Calculated Molecular Weight: 305 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC006990 Gene Symbol: PPP6C Gene ID (NCBI): 5537 RRID: AB_2168894 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00743 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.