Proteintech, 15857-1-AP, Histone H2B Polyclonal antibody

Size: 20ul / 150ul The Histone H2B (15857-1-AP) by Proteintech is a Polyclonal antibody targeting Histone H2B in WB, IHC, IF, IP, ELISA applications with reactivity to human, mouse, rat samples 15857-1-AP targets Histone H2B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse pancreas tissue, Jurkat cells, rat kidney tissue, HeLa cells, U2OS cells, mouse kidney tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human prostate cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF detected in: N/A Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF): IF : 1:10-1:100 Background Information Histone H2B is a core component of the nucleosome, the fundamental unit of chromatin. It forms a dimer with Histone H2A, and two H2A-H2B dimers combine with a (H3-H4)₂ tetramer to create the histone octamer. The primary function of this structure is to package DNA into a compact and manageable form. However, H2B is also subject to various post-translational modifications (PTMs), such as ubiquitination, which serve as epigenetic marks to regulate gene expression by altering chromatin accessibility. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7811 Product name: Recombinant human Histone H2B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-126 aa of BC005827 Sequence: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK Predict reactive species Full Name: histone cluster 2, H2be Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14-17 kDa GenBank Accession Number: BC005827 Gene Symbol: Histone H2B Gene ID (NCBI): 8349 RRID: AB_10664929 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16778 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.