Proteintech, 15870-1-AP, SPANXE Polyclonal antibody

Size: 20ul / 150ul The SPANXE (15870-1-AP) by Proteintech is a Polyclonal antibody targeting SPANXE in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 15870-1-AP targets SPANXE in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells, mouse skin tissue Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information SPANXE (Sperm protein associated with the nucleus on the X chromosome E), also known as SPANX A2 or SPANX C, is a member of the SPANX family. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene encodes a sperm protein that contains a consensus nuclear localization signal but, although a role in spermatogenesis is suggested, the specific function of this family member has not yet been determined. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8572 Product name: Recombinant human SPANXE protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-97 aa of BC005382 Sequence: MDKQSSAGGVKRSVPCDSNEANEMMPETSSGYSDPQPAPKKLKTSESSTILVVRYRRNVKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK Predict reactive species Full Name: SPANX family, member E Calculated Molecular Weight: 97 aa, 11 kDa Observed Molecular Weight: 15-20 kDa GenBank Accession Number: BC005382 Gene Symbol: SPANXE Gene ID (NCBI): 171489 RRID: AB_10951107 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.