Proteintech, 15886-1-AP, MOBKL3 Polyclonal antibody

Size: 20ul / 150ul The MOBKL3 (15886-1-AP) by Proteintech is a Polyclonal antibody targeting MOBKL3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15886-1-AP targets MOBKL3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells Positive IP detected in: K-562 cells Positive IHC detected in: human colon cancer tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:600-1:2400 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8671 Product name: Recombinant human MOBKL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC005237 Sequence: MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA Predict reactive species Full Name: MOB1, Mps One Binder kinase activator-like 3 (yeast) Calculated Molecular Weight: 225 aa, 26 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC005237 Gene Symbol: MOBKL3 Gene ID (NCBI): 25843 RRID: AB_10858478 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3A3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.