Proteintech, 15887-1-AP, EIF1, EIF1B Polyclonal antibody

Size: 20ul / 150ul The EIF1, EIF1B (15887-1-AP) by Proteintech is a Polyclonal antibody targeting EIF1, EIF1B in WB, IHC, ELISA applications with reactivity to human samples 15887-1-AP targets EIF1, EIF1B in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, HeLa cells, HepG2 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8673 Product name: Recombinant human EIF1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC006996 Sequence: MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF Predict reactive species Full Name: eukaryotic translation initiation factor 1B Calculated Molecular Weight: 113 aa, 13 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC006996 Gene Symbol: EIF1B Gene ID (NCBI): 10289 RRID: AB_2878196 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60739 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.