Proteintech, 15888-1-AP, MSMB Polyclonal antibody

Size: 20ul / 150ul The MSMB (15888-1-AP) by Proteintech is a Polyclonal antibody targeting MSMB in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples 15888-1-AP targets MSMB in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human urine sample Positive IHC detected in: human lung tissue, human prostate hyperplasia tissue, human kidney tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: LNCaP cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information MSMB is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in the uterus, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8674 Product name: Recombinant human MSMB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-114 aa of BC005257 Sequence: IPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII Predict reactive species Full Name: microseminoprotein, beta- Calculated Molecular Weight: 114 aa, 13 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC005257 Gene Symbol: MSMB Gene ID (NCBI): 4477 RRID: AB_2878197 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08118 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.