Iright
BRAND / VENDOR: Proteintech

Proteintech, 15892-1-AP, RNASE1 Polyclonal antibody

CATALOG NUMBER: 15892-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RNASE1 (15892-1-AP) by Proteintech is a Polyclonal antibody targeting RNASE1 in WB, ELISA applications with reactivity to Mouse, rat, human samples 15892-1-AP targets RNASE1 in WB, ELISA applications and shows reactivity with Mouse, rat, human samples. Tested Applications Positive WB detected in: mouse pancreas tissue, mouse stomach tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Specification Tested Reactivity: Mouse, rat, human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8679 Product name: Recombinant human RNASE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-156 aa of BC005324 Sequence: PSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST Predict reactive species Full Name: ribonuclease, RNase A family, 1 (pancreatic) Calculated Molecular Weight: 156 aa, 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC005324 Gene Symbol: RNASE1 Gene ID (NCBI): 6035 RRID: AB_3085473 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07998 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924