Proteintech, 15902-1-AP, GSTP1 Polyclonal antibody

Size: 20ul / 150ul The GSTP1 (15902-1-AP) by Proteintech is a Polyclonal antibody targeting GSTP1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 15902-1-AP targets GSTP1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, human brain tissue, HeLa cells, HEK-293 cells, K-562 cells, Jurkat cells, PC-3 cells, mouse brain tissue, mouse heart tissue, rat brain tissue, rat heart tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse skin tissue, human colon, human liver tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Glutathione S-transferase Pi (GSTP1) is anisozyme encoded by the GST pi gene that plays an importantregulatory role in detoxification, anti‑oxidative damage, and the occurrence of various diseases (PMID: 14755684). GSTP1 conjugates reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. It is involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PMID:9084911). GSTP1 methylation is frequently associated with tumor development or poor prognosis in a wide range of tumors such as neuroblastoma, hepatocellular carcinoma, endometrial, breast, and prostate cancers (PCa) (PMID: 27594734). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8731 Product name: Recombinant human GSTP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC010915 Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ Predict reactive species Full Name: glutathione S-transferase pi 1 Calculated Molecular Weight: 210 aa, 23 kDa Observed Molecular Weight: 23-28 kDa GenBank Accession Number: BC010915 Gene Symbol: GSTP1 Gene ID (NCBI): 2950 RRID: AB_2116216 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09211 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.