Proteintech, 15907-1-AP, MRPS2 Polyclonal antibody

Size: 20ul / 150ul The MRPS2 (15907-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS2 in IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15907-1-AP targets MRPS2 in IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8513 Product name: Recombinant human MRPS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-296 aa of BC008017 Sequence: MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHSL Predict reactive species Full Name: mitochondrial ribosomal protein S2 Calculated Molecular Weight: 296 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC008017 Gene Symbol: MRPS2 Gene ID (NCBI): 51116 RRID: AB_10642944 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y399 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.