Iright
BRAND / VENDOR: Proteintech

Proteintech, 15912-1-AP, UBE1 Polyclonal antibody

CATALOG NUMBER: 15912-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UBE1 (15912-1-AP) by Proteintech is a Polyclonal antibody targeting UBE1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15912-1-AP targets UBE1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, HEK-293 cells, mouse spleen tissue, rat spleen tissue, mouse colon tissue Positive IHC detected in: human colon cancer tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:200-1:1500 Background Information UBE1(Ubiquitin-activating enzyme E1) is also named as A1S9T, UBE1 and belongs to the ubiquitin-activating E1 family. It catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation and initiates the activation and conjugation of ubiquitin-like proteins. Defects in UBE1 are the cause of spinal muscular atrophy X-linked type 2 (SMAX2). UBE1 has two isoforms with the molecular mass of 118 and 114 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8703 Product name: Recombinant human UBE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 711-1058 aa of BC013041 Sequence: CHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR Predict reactive species Full Name: ubiquitin-like modifier activating enzyme 1 Calculated Molecular Weight: 1058 aa, 118 kDa Observed Molecular Weight: 114-118 kDa GenBank Accession Number: BC013041 Gene Symbol: UBA1 Gene ID (NCBI): 7317 RRID: AB_2211462 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22314 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924