Proteintech, 15928-1-AP, MRPS18C Polyclonal antibody

Size: 20ul / 150ul The MRPS18C (15928-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS18C in IP, ELISA applications with reactivity to human samples 15928-1-AP targets MRPS18C in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HepG2 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8771 Product name: Recombinant human MRPS18C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC005186 Sequence: MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRE Predict reactive species Full Name: mitochondrial ribosomal protein S18C Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC005186 Gene Symbol: MRPS18C Gene ID (NCBI): 51023 RRID: AB_3669226 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3D5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.