Proteintech, 15932-1-AP, IDH2 Polyclonal antibody

Size: 20ul / 150ul The IDH2 (15932-1-AP) by Proteintech is a Polyclonal antibody targeting IDH2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15932-1-AP targets IDH2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, HeLa cells, mouse heart tissue, mouse skeletal muscle tissue, mouse liver tissue, rat liver tissue, NIH/3T3 cells, SH-SY5Y cells, mouse brain tissue, HepG2 cells, K-562 cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human colon cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 contains an N-terminal mitochondrial addressing sequence and hence is imported to the mitochondrial matrix, although localization to nuclei has also been reported. Moreover, IDH2, like ~20% of other mitochondrial enzymes, is acetylated at lysines, which inactivates the enzymatic activity. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8779 Product name: Recombinant human IDH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 104-452 aa of BC009244 Sequence: TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ Predict reactive species Full Name: isocitrate dehydrogenase 2 (NADP+), mitochondrial Calculated Molecular Weight: 452 aa, 51 kDa Observed Molecular Weight: 41-47 kDa GenBank Accession Number: BC009244 Gene Symbol: IDH2 Gene ID (NCBI): 3418 RRID: AB_2264612 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48735 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.